PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 250aa    MW: 29181.6 Da    PI: 8.471
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01020.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.4e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll+ +vk +G g+W++ ar  g++R +k+c++rw +yl
       KHN01020.1 13 KGPWTSEEDRLLILYVKFHGEGRWNSAARLAGLKRNGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding49.97.5e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g  T++E+ ++ ++++++G++ W+tIar ++ gRt++++k++w+++
       KHN01020.1  66 KGQITPQEESIIQELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 110
                      5778******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.771860IPR017930Myb domain
SuperFamilySSF466895.62E-2910107IPR009057Homeodomain-like
SMARTSM007171.1E-121262IPR001005SANT/Myb domain
PfamPF002498.8E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-221466IPR009057Homeodomain-like
CDDcd001673.89E-91560No hitNo description
PROSITE profilePS5129423.46561115IPR017930Myb domain
SMARTSM007173.8E-1465113IPR001005SANT/Myb domain
PfamPF002499.8E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2567116IPR009057Homeodomain-like
CDDcd001672.30E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGWGVIEEEG WRKGPWTSEE DRLLILYVKF HGEGRWNSAA RLAGLKRNGK SCRLRWVNYL  60
RPDLKKGQIT PQEESIIQEL HARWGNRWST IARSLPGRTD NEIKNYWRTH FKKKMKTPSD  120
AAEKARIHSS RRQHFQQQQQ QLKQQQQQFQ FNLDMKGIIN LLEENDHRVP SISQEAQEMA  180
SMYPNTSEHQ GYFYSMFNVN DNDNNVSAPE SSNEEILWDG LWNLDDVLCN FNAASATSKA  240
SLHNLVSPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261311527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353810.0AC235381.1 Glycine max strain Williams 82 clone GM_WBb0111G18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628078.10.0PREDICTED: myb-related protein 305-like
TrEMBLI1NHY70.0I1NHY7_SOYBN; Uncharacterized protein
STRINGGLYMA20G34140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-81myb domain protein 305